Reaction Details |
| Report a problem with these data |
Target | 3-oxo-5-alpha-steroid 4-dehydrogenase 2 |
---|
Ligand | BDBM50031900 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_204743 (CHEMBL805436) |
---|
IC50 | 0.50±n/a nM |
---|
Citation | Frye, SV; Haffner, CD; Maloney, PR; Hiner, RN; Dorsey, GF; Noe, RA; Unwalla, RJ; Batchelor, KW; Bramson, HN; Stuart, JD Structure-activity relationships for inhibition of type 1 and 2 human 5 alpha-reductase and human adrenal 3 beta-hydroxy-delta 5-steroid dehydrogenase/3-keto-delta 5-steroid isomerase by 6-azaandrost-4-en-3-ones: optimization of the C17 substituent. J Med Chem38:2621-7 (1995) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
3-oxo-5-alpha-steroid 4-dehydrogenase 2 |
---|
Name: | 3-oxo-5-alpha-steroid 4-dehydrogenase 2 |
Synonyms: | 3-oxo-5-alpha-steroid 4-dehydrogenase 2 | 5 alpha-SR2 | 5α-Reductase 2 (5α-R2) | S5A2_HUMAN | SR type 2 | SRD5A2 | Steroid 5-alpha-reductase | Steroid 5-alpha-reductase 2 | Type II 5-alpha reductase |
Type: | Enzyme |
Mol. Mass.: | 28406.59 |
Organism: | Homo sapiens (Human) |
Description: | P31213 |
Residue: | 254 |
Sequence: | MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPARAAWFLQELPS
FAVPAGILARQPLSLFGPPGTVLLGLFCLHYFHRTFVYSLLNRGRPYPAILILRGTAFCT
GNGVLQGYYLIYCAEYPDGWYTDIRFSLGVFLFILGMGINIHSDYILRQLRKPGEISYRI
PQGGLFTYVSGANFLGEIIEWIGYALATWSLPALAFAFFSLCFLGLRAFHHHRFYLKMFE
DYPKSRKALIPFIF
|
|
|
BDBM50031900 |
---|
n/a |
---|
Name | BDBM50031900 |
Synonyms: | (1S,9aR,11aS)-9a,11a-Dimethyl-7-oxo-2,3,3a,3b,4,5,7,8,9,9a,9b,10,11,11a-tetradecahydro-1H-cyclopenta[i]phenanthridine-1-carboxylic acid (4'-tert-butyl-4-trifluoromethyl-biphenyl-2-yl)-amide | CHEMBL314069 |
Type | Small organic molecule |
Emp. Form. | C36H43F3N2O2 |
Mol. Mass. | 592.734 |
SMILES | CC(C)(C)c1ccc(cc1)-c1ccc(cc1NC(=O)[C@H]1CCC2C3CN=C4CC(=O)CC[C@]4(C)C3CC[C@]12C)C(F)(F)F |t:27| |
Structure |
|