Reaction Details |
| Report a problem with these data |
Target | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
---|
Ligand | BDBM50407405 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_204883 (CHEMBL808554) |
---|
Ki | 0.2±n/a nM |
---|
Citation | Frye, SV; Haffner, CD; Maloney, PR; Hiner, RN; Dorsey, GF; Noe, RA; Unwalla, RJ; Batchelor, KW; Bramson, HN; Stuart, JD Structure-activity relationships for inhibition of type 1 and 2 human 5 alpha-reductase and human adrenal 3 beta-hydroxy-delta 5-steroid dehydrogenase/3-keto-delta 5-steroid isomerase by 6-azaandrost-4-en-3-ones: optimization of the C17 substituent. J Med Chem38:2621-7 (1995) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
---|
Name: | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
Synonyms: | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 | 5α-Reductase 1 (5α-R1) | S5A1_HUMAN | S5AR | SR type 1 | SRD5A1 | Steroid 5-alpha-reductase | Steroid 5-alpha-reductase 1 |
Type: | Enzyme |
Mol. Mass.: | 29472.80 |
Organism: | Homo sapiens (Human) |
Description: | P18405 |
Residue: | 259 |
Sequence: | MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQE
LPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMA
IMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGD
TGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWY
LRKFEEYPKFRKIIIPFLF
|
|
|
BDBM50407405 |
---|
n/a |
---|
Name | BDBM50407405 |
Synonyms: | CHEMBL2115222 |
Type | Small organic molecule |
Emp. Form. | C27H29ClF6N2O2 |
Mol. Mass. | 562.975 |
SMILES | C[C@]12CC[C@H]3[C@@H](CN=C4C(Cl)C(=O)CC[C@]34C)[C@@H]1CC[C@@H]2C(=O)Nc1c(cccc1C(F)(F)F)C(F)(F)F |t:7| |
Structure |
|