| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50032526 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_145285 (CHEMBL752954) |
|---|
| Ki | 7.3±n/a nM |
|---|
| Citation |  Schmidhammer, H; Jennewein, HK; Krassnig, R; Traynor, JR; Patel, D; Bell, K; Froschauer, G; Mattersberger, K; Jachs-Ewinger, C; Jura, P Synthesis and biological evaluation of 14-alkoxymorphinans. 11. 3-Hydroxycyprodime and analogues: opioid antagonist profile in comparison to cyprodime. J Med Chem38:3071-7 (1995) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50032526 |
|---|
| n/a |
|---|
| Name | BDBM50032526 |
|---|
| Synonyms: | 17-allyl-4-hydroxy-3,10-dimethoxy-17-azatetracyclo[7.5.3.01,10.02,7]heptadeca-2(7),3,5-trien-13-one | CHEMBL317030 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H27NO4 |
|---|
| Mol. Mass. | 357.4434 |
|---|
| SMILES | COc1c(O)ccc2CC3N(CC=C)CCC4(CC(=O)CC[C@@]34OC)c12 |TLB:11:10:22:25.7.8,23:22:25.7.8:10.15.14,THB:2:25:22:10.15.14| |
|---|
| Structure | 
|
|---|
Search and Browse
