Reaction Details |
| Report a problem with these data |
Target | Translocator protein |
---|
Ligand | BDBM50052750 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_37061 (CHEMBL652449) |
---|
Ki | 1.4±n/a nM |
---|
Citation | Campiani, G; Nacci, V; Fiorini, I; De Filippis, MP; Garofalo, A; Ciani, SM; Greco, G; Novellino, E; Williams, DC; Zisterer, DM; Woods, MJ; Mihai, C; Manzoni, C; Mennini, T Synthesis, biological activity, and SARs of pyrrolobenzoxazepine derivatives, a new class of specific"peripheral-type" benzodiazepine receptor ligands. J Med Chem39:3435-50 (1996) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Translocator protein |
---|
Name: | Translocator protein |
Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
Type: | Mitochondrion membrane protein |
Mol. Mass.: | 18945.84 |
Organism: | Rattus norvegicus (rat) |
Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
Residue: | 169 |
Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
BDBM50052750 |
---|
n/a |
---|
Name | BDBM50052750 |
Synonyms: | CHEMBL115470 | Dimethyl-carbamic acid 5-(4-azido-phenyl)-6-oxa-10b-aza-benzo[e]azulen-4-yl ester |
Type | Small organic molecule |
Emp. Form. | C21H17N5O3 |
Mol. Mass. | 387.3914 |
SMILES | CN(C)C(=O)OC1=C(Oc2ccccc2-n2cccc12)c1ccc(cc1)N=[N+]=[N-] |t:6| |
Structure |
|