Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50056944 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_201892 (CHEMBL808183) |
---|
Ki | 190±n/a nM |
---|
Citation | el Ahmad, Y; Laurent, E; Maillet, P; Talab, A; Teste, JF; Dokhan, R; Tran, G; Ollivier, R New benzocycloalkylpiperazines, potent and selective 5-HT1A receptor ligands. J Med Chem40:952-60 (1997) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25266.54 |
Organism: | RAT |
Description: | Q9R0C9 |
Residue: | 223 |
Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
BDBM50056944 |
---|
n/a |
---|
Name | BDBM50056944 |
Synonyms: | 4-Fluoro-N-{2-[4-(1,2,3,4-tetrahydro-naphthalen-1-yl)-piperazin-1-yl]-ethyl}-benzamide | CHEMBL368061 |
Type | Small organic molecule |
Emp. Form. | C23H28FN3O |
Mol. Mass. | 381.4863 |
SMILES | Fc1ccc(cc1)C(=O)NCCN1CCN(CC1)C1CCCc2ccccc12 |
Structure |
|