| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50369518 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_145280 (CHEMBL751216) |
|---|
| Ki | 0.210000±n/a nM |
|---|
| Citation |  Neumeyer, JL; Bidlack, JM; Zong, R; Bakthavachalam, V; Gao, P; Cohen, DJ; Negus, SS; Mello, NK Synthesis and opioid receptor affinity of morphinan and benzomorphan derivatives: mixed kappa agonists and mu agonists/antagonists as potential pharmacotherapeutics for cocaine dependence. J Med Chem43:114-22 (2000) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50369518 |
|---|
| n/a |
|---|
| Name | BDBM50369518 |
|---|
| Synonyms: | LEVORPHANOL HYDROCHLORIDE |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H23NO |
|---|
| Mol. Mass. | 257.3706 |
|---|
| SMILES | CN1CC[C@]23CCCC[C@H]2[C@H]1Cc1ccc(O)cc31 |TLB:0:1:9:11.12.18| |
|---|
| Structure | 
|
|---|
Search and Browse
