Reaction Details |
| Report a problem with these data |
Target | 3',5'-cyclic-AMP phosphodiesterase |
---|
Ligand | BDBM14361 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_155663 (CHEMBL763047) |
---|
IC50 | 3630±n/a nM |
---|
Citation | Watanabe, N; Adachi, H; Takase, Y; Ozaki, H; Matsukura, M; Miyazaki, K; Ishibashi, K; Ishihara, H; Kodama, K; Nishino, M; Kakiki, M; Kabasawa, Y 4-(3-Chloro-4-methoxybenzyl)aminophthalazines: synthesis and inhibitory activity toward phosphodiesterase 5. J Med Chem43:2523-9 (2000) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
3',5'-cyclic-AMP phosphodiesterase |
---|
Name: | 3',5'-cyclic-AMP phosphodiesterase |
Synonyms: | Phosphodiesterase 4A |
Type: | PROTEIN |
Mol. Mass.: | 13615.65 |
Organism: | Sus scrofa |
Description: | ChEMBL_155848 |
Residue: | 118 |
Sequence: | PWLVGWWDQFKRMLNRELTHLSEMSRSGNQVSEYISTTFLDKQNEVDIPSPTMKDHEKQQ
APRQRPSQQPPPPGPQFQPMSQITGVKKLMHSSSLNEDSSIPRFGVKTDQEELLAQEL
|
|
|
BDBM14361 |
---|
n/a |
---|
Name | BDBM14361 |
Synonyms: | (R,S)-Rolipram | 4-(3-cyclopentyloxy-4-methoxy-phenyl)pyrrolidin-2-one | 4-[3-(cyclopentyloxy)-4-methoxyphenyl]pyrrolidin-2-one | Adeo | CHEMBL63 | Rolipram |
Type | Small organic molecule |
Emp. Form. | C16H21NO3 |
Mol. Mass. | 275.3428 |
SMILES | COc1ccc(cc1OC1CCCC1)C1CNC(=O)C1 |
Structure |
|