| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 1 |
|---|
| Ligand | BDBM7579 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_50319 (CHEMBL661624) |
|---|
| IC50 | 150±n/a nM |
|---|
| Citation |  Ducrot, P; Legraverend, M; Grierson, DS 3D-QSAR CoMFA on cyclin-dependent kinase inhibitors. J Med Chem43:4098-108 (2000) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-dependent kinase 1 |
|---|
| Name: | Cyclin-dependent kinase 1 |
|---|
| Synonyms: | CDC2 | CDC28A | CDK1 | CDK1_HUMAN | CDKN1 | Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | P34CDC2 | p34 protein kinase |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 34101.08 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P06493 |
|---|
| Residue: | 297 |
|---|
| Sequence: | MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
|
|
|
|---|
| BDBM7579 |
|---|
| n/a |
|---|
| Name | BDBM7579 |
|---|
| Synonyms: | 1-(6-{[4-(dimethylamino)benzyl]amino}-9-isopropyl-9H-purin-2-yl)-3-methylpent-1-yn-3-ol | 1-[6-({[4-(dimethylamino)phenyl]methyl}amino)-9-(propan-2-yl)-9H-purin-2-yl]-3-methylpent-1-yn-3-ol | C-2 alkynylated purine deriv. 4h | CHEMBL23525 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H30N6O |
|---|
| Mol. Mass. | 406.5239 |
|---|
| SMILES | CCC(C)(O)C#Cc1nc(NCc2ccc(cc2)N(C)C)c2ncn(C(C)C)c2n1 |
|---|
| Structure | 
|
|---|
Search and Browse
