| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptidyl-prolyl cis-trans isomerase A |
|---|
| Ligand | BDBM50087872 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_154349 (CHEMBL759111) |
|---|
| IC50 | 2500000±n/a nM |
|---|
| Citation |  Li, Q; Moutiez, M; Charbonnier, JB; Vaudry, K; Ménez, A; Quéméneur, E; Dugave, C Design of a Gag pentapeptide analogue that binds human cyclophilin A more efficiently than the entire capsid protein: new insights for the development of novel anti-HIV-1 drugs. J Med Chem43:1770-9 (2000) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptidyl-prolyl cis-trans isomerase A |
|---|
| Name: | Peptidyl-prolyl cis-trans isomerase A |
|---|
| Synonyms: | CYPA | CYPA PPIase | Cyclophilin A | Cyclosporin A-binding protein | PPIA | PPIA_HUMAN | PPIase A | Peptidyl-prolyl cis-trans isomerase A | Rotamase A |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 18015.32 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P62937 |
|---|
| Residue: | 165 |
|---|
| Sequence: | MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGF
MCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTE
WLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
|
|
|
|---|
| BDBM50087872 |
|---|
| n/a |
|---|
| Name | BDBM50087872 |
|---|
| Synonyms: | 2-(2-Acetylamino-3-methyl-butyrylamino)-pentanedioic acid 5-amide 1-{[1-(2-{2-[1-(1-carbamoyl-ethylcarbamoyl)-2-methyl-butylcarbamoyl]-pyrrolidin-1-yl}-2-oxo-ethylcarbamoyl)-ethyl]-amide} | CHEMBL49783 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H53N9O9 |
|---|
| Mol. Mass. | 695.8074 |
|---|
| SMILES | CC[C@@H](C)[C@@H](NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(C)=O)C(C)C)C(=O)N[C@H](C)C(N)=O |
|---|
| Structure | 
|
|---|
Search and Browse
