| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 4 |
|---|
| Ligand | BDBM50078561 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_3371 (CHEMBL620608) |
|---|
| Ki | >1000±n/a nM |
|---|
| Citation |  López-Rodríguez, ML; Morcillo, MJ; Fernández, E; Porras, E; Orensanz, L; Beneytez, ME; Manzanares, J; Fuentes, JA Synthesis and structure-activity relationships of a new model of arylpiperazines. 5. Study of the physicochemical influence of the pharmacophore on 5-HT(1a)/alpha(1)-adrenergic receptor affinity: synthesis of a new derivative with mixed 5-HT(1a)/d(2) antagonist properties. J Med Chem44:186-97 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 5-hydroxytryptamine receptor 4 |
|---|
| Name: | 5-hydroxytryptamine receptor 4 |
|---|
| Synonyms: | 5-HT-4 | 5-HT4 | 5-HT4S | 5-HT4a | 5-HT4b | 5-HT4c | 5-HT4d | 5-HT4hb | 5-hydroxytryptamine receptor 4 | 5-hydroxytryptamine receptor 4 (5-HT4) | 5HT4R_HUMAN | HTR4 | Serotonin (5-HT) receptor | Serotonin (5-HT3) receptor | Serotonin 4 (5-HT4) receptor | Serotonin Receptor 4 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 43767.54 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q13639 |
|---|
| Residue: | 388 |
|---|
| Sequence: | MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYY
AICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSN
STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRP
QSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWL
GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRD
AVECGGQWESQCHPPATSPLVAAQPSDT
|
|
|
|---|
| BDBM50078561 |
|---|
| n/a |
|---|
| Name | BDBM50078561 |
|---|
| Synonyms: | CHEMBL1204203 | CHEMBL416266 | Ethanesulfonic acid (3-{4-[4-(1,3-dioxo-tetrahydro-pyrrolo[1,2-c]imidazol-2-yl)-butyl]-piperazin-1-yl}-phenyl)-amide | Ethanesulfonic acid (3-{4-[4-(1,3-dioxo-tetrahydro-pyrrolo[1,2-c]imidazol-2-yl)-butyl]-piperazin-1-yl}-phenyl)-amide (EF-7412) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H33N5O4S |
|---|
| Mol. Mass. | 463.594 |
|---|
| SMILES | CCS(=O)(=O)Nc1cccc(c1)N1CCN(CCCCn2c(O)c3CCCn3c2=O)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
