Reaction Details |
| Report a problem with these data |
Target | Translocator protein |
---|
Ligand | BDBM50105061 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_39278 (CHEMBL650539) |
---|
IC50 | 1040±n/a nM |
---|
Citation | Poulain, R; Horvath, D; Bonnet, B; Eckhoff, C; Chapelain, B; Bodinier, MC; Déprez, B From hit to lead. Analyzing structure-profile relationships. J Med Chem44:3391-401 (2001) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Translocator protein |
---|
Name: | Translocator protein |
Synonyms: | BZRP | MBR | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor-related protein | Peripheral-type benzodiazepine receptor | TSPO | TSPO_HUMAN |
Type: | Enzyme |
Mol. Mass.: | 18834.74 |
Organism: | Homo sapiens (Human) |
Description: | P30536 |
Residue: | 169 |
Sequence: | MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA
ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
|
|
|
BDBM50105061 |
---|
n/a |
---|
Name | BDBM50105061 |
Synonyms: | 4-(2-Oxo-2,3-dihydro-benzoimidazol-1-yl)-piperidine-1-carboxylic acid 6-chloro-benzo[1,3]dioxol-5-ylmethyl ester | CHEMBL115444 |
Type | Small organic molecule |
Emp. Form. | C21H20ClN3O5 |
Mol. Mass. | 429.854 |
SMILES | Clc1cc2OCOc2cc1COC(=O)N1CCC(CC1)n1c2ccccc2[nH]c1=O |
Structure |
|