Reaction Details |
| Report a problem with these data |
Target | Chymase |
---|
Ligand | BDBM87059 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_197664 (CHEMBL807473) |
---|
Ki | 13.1±n/a nM |
---|
Citation | Akahoshi, F; Ashimori, A; Sakashita, H; Yoshimura, T; Imada, T; Nakajima, M; Mitsutomi, N; Kuwahara, S; Ohtsuka, T; Fukaya, C; Miyazaki, M; Nakamura, N Synthesis, structure-activity relationships, and pharmacokinetic profiles of nonpeptidic alpha-keto heterocycles as novel inhibitors of human chymase. J Med Chem44:1286-96 (2001) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Chymase |
---|
Name: | Chymase |
Synonyms: | Alpha-chymase | CMA1 | CMA1_HUMAN | CYH | CYM | Chymase precursor | Mast cell protease I |
Type: | Enzyme |
Mol. Mass.: | 27340.12 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 247 |
Sequence: | MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNF
VLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKA
SLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRD
FDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWI
NQILQAN
|
|
|
BDBM87059 |
---|
n/a |
---|
Name | BDBM87059 |
Synonyms: | CHEMBL247767 | Chymostatin |
Type | Small organic molecule |
Emp. Form. | C31H41N7O6 |
Mol. Mass. | 607.7005 |
SMILES | CC(C)C[C@H](NC(=O)[C@@H](NC(=O)N[C@@H](Cc1ccccc1)C(O)=O)C1CCNC(N)=N1)C(=O)N[C@@H](Cc1ccccc1)C=O |c:30| |
Structure |
|