Reaction Details |
| Report a problem with these data |
Target | Chymase |
---|
Ligand | BDBM50098874 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_197662 (CHEMBL807472) |
---|
Ki | 2.62±n/a nM |
---|
Citation | Akahoshi, F; Ashimori, A; Sakashita, H; Yoshimura, T; Eda, M; Imada, T; Nakajima, M; Mitsutomi, N; Kuwahara, S; Ohtsuka, T; Fukaya, C; Miyazaki, M; Nakamura, N Synthesis, structure-activity relationships, and pharmacokinetic profiles of nonpeptidic difluoromethylene ketones as novel inhibitors of human chymase. J Med Chem44:1297-304 (2001) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Chymase |
---|
Name: | Chymase |
Synonyms: | Alpha-chymase | CMA1 | CMA1_HUMAN | CYH | CYM | Chymase precursor | Mast cell protease I |
Type: | Enzyme |
Mol. Mass.: | 27340.12 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 247 |
Sequence: | MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNF
VLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKA
SLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRD
FDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWI
NQILQAN
|
|
|
BDBM50098874 |
---|
n/a |
---|
Name | BDBM50098874 |
Synonyms: | 4-{2-[5-Amino-2-(3-chloro-phenyl)-6-oxo-6H-pyrimidin-1-yl]-acetylamino}-2,2-difluoro-3-oxo-5-phenyl-pentanoic acid benzylamide | CHEMBL24734 |
Type | Small organic molecule |
Emp. Form. | C30H26ClF2N5O4 |
Mol. Mass. | 594.008 |
SMILES | Nc1cnc(-c2cccc(Cl)c2)n(CC(=O)NC(Cc2ccccc2)C(=O)C(F)(F)C(=O)NCc2ccccc2)c1=O |
Structure |
|