Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50128107 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_201912 (CHEMBL808202) |
---|
Ki | 0.34±n/a nM |
---|
Citation | Berardi, F; Loiodice, F; Fracchiolla, G; Colabufo, NA; Perrone, R; Tortorella, V Synthesis of chiral 1-[omega-(4-chlorophenoxy)alkyl]-4-methylpiperidines and their biological evaluation at sigma1, sigma2, and sterol delta8-delta7 isomerase sites. J Med Chem46:2117-24 (2003) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM50128107 |
---|
n/a |
---|
Name | BDBM50128107 |
Synonyms: | 1-[2-(4-Chloro-phenoxy)-1-methyl-ethyl]-4-methyl-piperidine; hydrochloride | CHEMBL555790 |
Type | Small organic molecule |
Emp. Form. | C15H22ClNO |
Mol. Mass. | 267.794 |
SMILES | C[C@@H](COc1ccc(Cl)cc1)N1CCC(C)CC1 |
Structure |
|