| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine protease 1 |
|---|
| Ligand | BDBM50131974 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_39228 (CHEMBL655074) |
|---|
| Ki | 81±n/a nM |
|---|
| Citation |  Costanzo, MJ; Yabut, SC; Almond, HR; Andrade-Gordon, P; Corcoran, TW; De Garavilla, L; Kauffman, JA; Abraham, WM; Recacha, R; Chattopadhyay, D; Maryanoff, BE Potent, small-molecule inhibitors of human mast cell tryptase. Antiasthmatic action of a dipeptide-based transition-state analogue containing a benzothiazole ketone. J Med Chem46:3865-76 (2003) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Serine protease 1 |
|---|
| Name: | Serine protease 1 |
|---|
| Synonyms: | Alpha-trypsin chain 1 | Alpha-trypsin chain 2 | Beta-trypsin | Cationic trypsinogen | PRSS1 | Serine protease 1 | TRP1 | TRY1 | TRY1_HUMAN | TRYP1 | Thrombin & trypsin | Trypsin | Trypsin I | Trypsin-1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 26557.80 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P07477 |
|---|
| Residue: | 247 |
|---|
| Sequence: | MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS
|
|
|
|---|
| BDBM50131974 |
|---|
| n/a |
|---|
| Name | BDBM50131974 |
|---|
| Synonyms: | 1-Acetyl-4-hydroxy-pyrrolidine-2-carboxylic acid [4-guanidino-1-(thiazole-2-carbonyl)-butyl]-amide; TFA | CHEMBL341083 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H24N6O4S |
|---|
| Mol. Mass. | 396.465 |
|---|
| SMILES | CC(=O)N1C[C@H](O)C[C@H]1C(=O)NC(CCCNC(N)=N)C(=O)c1nccs1 |
|---|
| Structure | 
|
|---|
Search and Browse
