| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tryptase beta-2 |
|---|
| Ligand | BDBM50131976 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_210835 (CHEMBL811864) |
|---|
| Ki | 14000±n/a nM |
|---|
| Citation |  Costanzo, MJ; Yabut, SC; Almond, HR; Andrade-Gordon, P; Corcoran, TW; De Garavilla, L; Kauffman, JA; Abraham, WM; Recacha, R; Chattopadhyay, D; Maryanoff, BE Potent, small-molecule inhibitors of human mast cell tryptase. Antiasthmatic action of a dipeptide-based transition-state analogue containing a benzothiazole ketone. J Med Chem46:3865-76 (2003) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Tryptase beta-2 |
|---|
| Name: | Tryptase beta-2 |
|---|
| Synonyms: | TPS2 | TPSB2 | TRYB2_HUMAN | Tryptase | Tryptase II | Tryptase beta-1 | Tryptase-2 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 30518.79 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_210702 |
|---|
| Residue: | 275 |
|---|
| Sequence: | MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCG
GSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGA
DIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKV
PIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAG
VVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
|
|
|
|---|
| BDBM50131976 |
|---|
| n/a |
|---|
| Name | BDBM50131976 |
|---|
| Synonyms: | 1-Acetyl-pyrrolidine-2-carboxylic acid [1-(benzothiazole-2-carbonyl)-4-guanidino-butyl]-amide; TFA | CHEMBL127185 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H26N6O3S |
|---|
| Mol. Mass. | 430.524 |
|---|
| SMILES | CC(=O)N1CCC[C@@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)c1nc2ccccc2s1 |
|---|
| Structure | 
|
|---|
Search and Browse
