Reaction Details |
| Report a problem with these data |
Target | D(4) dopamine receptor |
---|
Ligand | BDBM50001884 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_63101 (CHEMBL674494) |
---|
Ki | 30±n/a nM |
---|
Citation | Balle, T; Perregaard, J; Ramirez, MT; Larsen, AK; Søby, KK; Liljefors, T; Andersen, K Synthesis and structure-affinity relationship investigations of 5-heteroaryl-substituted analogues of the antipsychotic sertindole. A new class of highly selective alpha(1) adrenoceptor antagonists. J Med Chem46:265-83 (2003) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
D(4) dopamine receptor |
---|
Name: | D(4) dopamine receptor |
Synonyms: | D(2C) dopamine receptor | DOPAMINE D4 | DOPAMINE D4.2 | DOPAMINE D4.4 | DRD4 | DRD4_HUMAN | Dopamine D4 receptor |
Type: | Enzyme |
Mol. Mass.: | 48373.19 |
Organism: | Homo sapiens (Human) |
Description: | P21917 |
Residue: | 419 |
Sequence: | MGNRSTADADGLLAGRGPAAGASAGASAGLAGQGAAALVGGVLLIGAVLAGNSLVCVSVA
TERALQTPTNSFIVSLAAADLLLALLVLPLFVYSEVQGGAWLLSPRLCDALMAMDVMLCT
ASIFNLCAISVDRFVAVAVPLRYNRQGGSRRQLLLIGATWLLSAAVAAPVLCGLNDVRGR
DPAVCRLEDRDYVVYSSVCSFFLPCPLMLLLYWATFRGLQRWEVARRAKLHGRAPRRPSG
PGPPSPTPPAPRLPQDPCGPDCAPPAPGLPRGPCGPDCAPAAPSLPQDPCGPDCAPPAPG
LPPDPCGSNCAPPDAVRAAALPPQTPPQTRRRRRAKITGRERKAMRVLPVVVGAFLLCWT
PFFVVHITQALCPACSVPPRLVSAVTWLGYVNSALNPVIYTVFNAEFRNVFRKALRACC
|
|
|
BDBM50001884 |
---|
n/a |
---|
Name | BDBM50001884 |
Synonyms: | 2-[4-(4-Methyl-benzyl)-piperazin-1-yl]-1-(2-methyl-2,3-dihydro-indol-1-yl)-ethanone | 3-Hydroxy-2-phenyl-propionic acid 8-methyl-8-aza-bicyclo[3.2.1]oct-3-yl ester | 3-chloro-6-(4-methyl-piperazin-1-yl)-5H-dibenzo[b,e][1,4]diazepine | 8-Chloro-11-(4-methyl-piperazin-1-yl)-5H-dibenzo[b,e][1,4]diazepine (Clozapine) | 8-Chloro-11-(4-methyl-piperazin-1-yl)-5H-dibenzo[b,e][1,4]diazepine( Clozepine ) | 8-Chloro-11-(4-methyl-piperazin-1-yl)-5H-dibenzo[b,e][1,4]diazepine(Ciozapine) | 8-Chloro-11-(4-methyl-piperazin-1-yl)-5H-dibenzo[b,e][1,4]diazepine(Clopazine) | 8-chloro-11-(4-methyl-piperazin-1-yl)-10H-dibenzo[b,e][1,4]diazepine | 8-chloro-11-(4-methylpiperazin-1-yl)-5H-dibenzo[b,e][1,4]diazepine | CHEMBL42 | CHEMBL538973 | CLOZAPINE | CLOZAPINE, 8-CHLORO-11-(4-METHYL-PIPERAZIN-1-YL)-5H-DIBENZO[B,E][1,4]DIAZEPINE | CLOZARIL | HF 1854 | US10167256, Clozapine | US10752588, Compound Clozapine | US11498896, Compound Clozapine |
Type | Small organic molecule |
Emp. Form. | C18H19ClN4 |
Mol. Mass. | 326.823 |
SMILES | CN1CCN(CC1)C1=Nc2cc(Cl)ccc2Nc2ccccc12 |t:8| |
Structure |
|