| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50163697 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_303178 (CHEMBL829672) |
|---|
| Ki | 3000±n/a nM |
|---|
| Citation |  Hwang, YS; Chmielewski, J Development of low molecular weight HIV-1 protease dimerization inhibitors. J Med Chem48:2239-42 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50163697 |
|---|
| n/a |
|---|
| Name | BDBM50163697 |
|---|
| Synonyms: | (S)-2-[(R)-3-Carbamoyl-3-(15-{(S)-1-[(S)-1-((S)-1-carbamoyl-2-phenyl-ethylcarbamoyl)-3-methyl-butylcarbamoyl]-2-hydroxy-propylcarbamoyl}-pentadecanoylamino)-propionylamino]-3-phenyl-propionic acid | CHEMBL195072 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C48H73N7O10 |
|---|
| Mol. Mass. | 908.1341 |
|---|
| SMILES | CC(C)C[C@H](NC(=O)[C@@H](NC(=O)CCCCCCCCCCCCCCC(=O)N[C@H](CC(=O)N[C@@H](Cc1ccccc1)C(O)=O)C(N)=O)C(C)O)C(=O)N[C@@H](Cc1ccccc1)C(N)=O |
|---|
| Structure | 
|
|---|
Search and Browse
