Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSodium-dependent serotonin transporter
LigandBDBM50109061
Substrate/Competitorn/a
Meas. Tech.ChEMBL_320752
Ki 1.5±n/a nM
Citation Morphy RRankovic Z Designed multiple ligands. An emerging drug discovery paradigm. J Med Chem 48:6523-43 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sodium-dependent serotonin transporter
Name:Sodium-dependent serotonin transporter
Synonyms:5-HT Transporter | 5HT transporter | 5HTT | SERT | SLC6A4 | Serotonin Transporter (SERT) | Serotonin transporter (5HTT) | Serotonin transporter protein (SERT) | Sodium-dependent serotonin transporter (SERT) | Solute carrier family 6 member 4
Type:Multi-pass membrane protein
Mol. Mass.:70322.51
Organism:Homo sapiens (Human)
Description:P31645
Residue:630
Sequence:
METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTR
HSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLP
YTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIM
AWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIH
RSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGA
TLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQD
ALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPAS
TFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVT
LTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRIC
WVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIIT
PGTFKERIIKSITPETPTEIPCGDIRLNAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50109061
n/a
NameBDBM50109061
Synonyms:3-{1-[2-(1H-Indol-4-yloxy)-ethyl]-1,2,3,6-tetrahydro-pyridin-4-yl}-1H-pyrrolo[2,3-b]pyridine | CHEMBL104229
TypeSmall organic molecule
Emp. Form.C22H22N4O
Mol. Mass.358.4363
SMILESC(CN1CCC(=CC1)c1c[nH]c2ncccc12)Oc1cccc2[nH]ccc12 |c:5|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: