| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gamma-aminobutyric acid receptor subunit alpha-1 |
|---|
| Ligand | BDBM23183 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_321555 (CHEMBL881969) |
|---|
| IC50 | 16±n/a nM |
|---|
| Citation |  Minetti, P; Tinti, MO; Carminati, P; Castorina, M; Di Cesare, MA; Di Serio, S; Gallo, G; Ghirardi, O; Giorgi, F; Giorgi, L; Piersanti, G; Bartoccini, F; Tarzia, G 2-n-Butyl-9-methyl-8-[1,2,3]triazol-2-yl-9H-purin-6-ylamine and analogues as A2A adenosine receptor antagonists. Design, synthesis, and pharmacological characterization. J Med Chem48:6887-96 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gamma-aminobutyric acid receptor subunit alpha-1 |
|---|
| Name: | Gamma-aminobutyric acid receptor subunit alpha-1 |
|---|
| Synonyms: | Benzodiazepine central | Benzodiazepine receptors | GABA A Benzodiazepine | GABA A Benzodiazepine Type I | GABA A Benzodiazepine Type II | GABA A Benzodiazepine Type IIL | GABA A Benzodiazepine Type IIM | GABA A Benzodiazepine omega1 | GABA A Benzodiazepine omega2 | GABA A Benzodiazepine omega5 | GABA A alpha1 | GABA A anti-Alpha1 | GABA receptor alpha-1 subunit | GABA, Chloride, TBOB | GABA-PICROTOXIN | GBRA1_RAT | Gabra-1 | Gabra1 | TBPS |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 51770.21 |
|---|
| Organism: | Rattus norvegicus (Rat) |
|---|
| Description: | P62813 |
|---|
| Residue: | 455 |
|---|
| Sequence: | MKKSRGLSDYLWAWTLILSTLSGRSYGQPSQDELKDNTTVFTRILDRLLDGYDNRLRPGL
GERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASKI
WTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACP
LKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVMT
THFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISAR
NSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDPL
IKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKTFNSVSKIDR
LSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ
|
|
|
|---|
| BDBM23183 |
|---|
| n/a |
|---|
| Name | BDBM23183 |
|---|
| Synonyms: | 5-(aminomethyl)-1,2-oxazol-3-ol | Agarin | CHEMBL273481 | Muscimol | Pantherine |
|---|
| Type | GABA Agonist |
|---|
| Emp. Form. | C4H6N2O2 |
|---|
| Mol. Mass. | 114.1026 |
|---|
| SMILES | NCc1cc(=O)[nH]o1 |
|---|
| Structure | 
|
|---|
Search and Browse
