Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOxytocin receptor
LigandBDBM50178153
Substrate/Competitorn/a
Meas. Tech.ChEMBL_326541
Ki 25±n/a nM
Citation Quattropani ADorbais JCovini DPittet PAColovray VThomas RJCoxhead RHalazy SScheer AMissotten MAyala GBradshaw CDe Raemy-Schenk AMNichols ACirillo RTos EGGiachetti CGolzio LMarinelli PChurch DJBarberis CChollet ASchwarz MK Discovery and development of a new class of potent, selective, orally active oxytocin receptor antagonists. J Med Chem 48:7882-905 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Oxytocin receptor
Name:Oxytocin receptor
Synonyms:OT-R | Oxytocin
Type:Enzyme Catalytic Domain
Mol. Mass.:42889.28
Organism:RAT
Description:Oxytocin OXTR RAT::P70536
Residue:388
Sequence:
MEGTPAANWSVELDLGSGVPPGEEGNRTAGPPQRNEALARVEVAVLCLILFLALSGNACV
LLALRTTRHKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQV
VGMFASTYLLLLMSLDRCLAICQPLRSLRRRTDRLAVLGTWLGCLVASAPQVHIFSLREV
ADGVFDCWAVFIQPWGPKAYVTWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTAAAAA
AAEGNDAAGGAGRAALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVWD
VNAPKEASAFIIAMLLASLNSCCNPWIYMLFTGHLFHELVQRFFCCSARYLKGSRPGETS
VSKKSNSSTFVLSRRSSSQRSCSQPSSA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50178153
n/a
NameBDBM50178153
Synonyms:4-ethoxy-N-(4-methylphenyl)-N-{2-oxo-2-[2-(2-oxo-1,2-dihydro-3H-indol-3-ylidene)hydrazino]ethyl}benzenesulfonamide | CHEMBL199623
TypeSmall organic molecule
Emp. Form.C25H26N4O5S
Mol. Mass.494.563
SMILESCCOc1ccc(cc1)S(=O)(=O)N(CC(=O)NN=C1C(=O)NC2C=CCC=C12)c1ccc(C)cc1 |w:17.17,c:24,t:27|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: