| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Integrase |
|---|
| Ligand | BDBM23399 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_355513 (CHEMBL863032) |
|---|
| IC50 | 20±n/a nM |
|---|
| Citation |  Walker, MA; Johnson, T; Ma, Z; Banville, J; Remillard, R; Kim, O; Zhang, Y; Staab, A; Wong, H; Torri, A; Samanta, H; Lin, Z; Deminie, C; Terry, B; Krystal, M; Meanwell, N Triketoacid inhibitors of HIV-integrase: a new chemotype useful for probing the integrase pharmacophore. Bioorg Med Chem Lett16:2920-4 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Integrase |
|---|
| Name: | Integrase |
|---|
| Synonyms: | Human immunodeficiency virus type 1 integrase |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 32231.48 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | ChEMBL_90865 |
|---|
| Residue: | 288 |
|---|
| Sequence: | FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED
|
|
|
|---|
| BDBM23399 |
|---|
| n/a |
|---|
| Name | BDBM23399 |
|---|
| Synonyms: | 4-{1-[(4-fluorophenyl)methyl]-1H-pyrrol-2-yl}-2,4-dioxobutanoic acid | CHEMBL421353 | CHEMBL50605 | L-731988 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H12FNO4 |
|---|
| Mol. Mass. | 289.2585 |
|---|
| SMILES | OC(=O)C(=O)CC(=O)c1cccn1Cc1ccc(F)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
