| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 1 |
|---|
| Ligand | BDBM6619 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_404509 (CHEMBL910892) |
|---|
| IC50 | 122±n/a nM |
|---|
| Citation |  Kawanishi, N; Sugimoto, T; Shibata, J; Nakamura, K; Masutani, K; Ikuta, M; Hirai, H Structure-based drug design of a highly potent CDK1,2,4,6 inhibitor with novel macrocyclic quinoxalin-2-one structure. Bioorg Med Chem Lett16:5122-6 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-dependent kinase 1 |
|---|
| Name: | Cyclin-dependent kinase 1 |
|---|
| Synonyms: | CDC2 | CDC28A | CDK1 | CDK1_HUMAN | CDKN1 | Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | P34CDC2 | p34 protein kinase |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 34101.08 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P06493 |
|---|
| Residue: | 297 |
|---|
| Sequence: | MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
|
|
|
|---|
| BDBM6619 |
|---|
| n/a |
|---|
| Name | BDBM6619 |
|---|
| Synonyms: | 3-[(9bR)-5-oxo-1H,2H,3H,5H,9bH-benzo[a]pyrrolizin-9-yl]-1-pyridin-2-ylurea | CHEMBL141247 | N -(pyrrolidino[2,1-b]isoindolin-4-on-8-yl)-N-(pyridin-2yl)urea | Pyridin-2-yl urea | diarylurea deriv. 1 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H16N4O2 |
|---|
| Mol. Mass. | 308.3345 |
|---|
| SMILES | O=C(Nc1ccccn1)Nc1cccc2C(=O)N3CCC[C@@H]3c12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
