Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRibosomal protein S6 kinase 2/S6K1
LigandBDBM50192071
Substrate/Competitorn/a
Meas. Tech.ChEMBL_404545
IC50>1000±n/a nM
Citation Kawanishi NSugimoto TShibata JNakamura KMasutani KIkuta MHirai H Structure-based drug design of a highly potent CDK1,2,4,6 inhibitor with novel macrocyclic quinoxalin-2-one structure. Bioorg Med Chem Lett 16:5122-6 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ribosomal protein S6 kinase 2/S6K1
Name:Ribosomal protein S6 kinase 2/S6K1
Synonyms:Ribosomal protein S6 kinase (P70S6K) | Ribosomal protein S6 kinase 1/2
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of EBI is 195569
Components:This complex has 2 components.
Component 1
Name:Ribosomal protein S6 kinase (P70S6K)
Synonyms:70 kDa ribosomal protein S6 kinase 1 | 70 kDa ribosomal protein S6 kinase 1 (P70s6k) | 70 kDa ribosomal protein kinase (p70S6K) | Protein kinase 70S6K (T412E) | Ribosomal protein S6 kinase I | S6K1 | p70 S6 ribosomal protein kinase 1 | p70S6K1
Type:Enzyme
Mol. Mass.:59139.89
Organism:Homo sapiens (Human)
Description:His-tagged S6K1.
Residue:525
Sequence:
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG
IEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Ribosomal protein S6 kinase (P70S6K)
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:53460.10
Organism:Homo sapiens (Human)
Description:ChEMBL_306115
Residue:482
Sequence:
MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELTETSVNVGPE
RIGPHCFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVRNAKDTAHTRAER
NILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITL
ALGHLHSQGIIYRDLKPENIMLSSQGHIKLTDFGLCKESIHEGAVTHTFCGTIEYMAPEI
LVRSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIRGKLALPPYLTPDARDLV
KKFLKRNPSQRIGGGPGDAADVQRHPFFRHMNWDDLLAWRVDPPFRPCLQSEEDVSQFDT
RFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRA
PVSPLKFSPFEGFRPSPSLPEPTELPLPPLLPPPPPSTTAPLPIRPPSGTKKSKRGRGRP
GR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 3
Name:Ribosomal protein S6 kinase (P70S6K)
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:53460.10
Organism:Homo sapiens (Human)
Description:ChEMBL_306115
Residue:482
Sequence:
MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELTETSVNVGPE
RIGPHCFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVRNAKDTAHTRAER
NILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITL
ALGHLHSQGIIYRDLKPENIMLSSQGHIKLTDFGLCKESIHEGAVTHTFCGTIEYMAPEI
LVRSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIRGKLALPPYLTPDARDLV
KKFLKRNPSQRIGGGPGDAADVQRHPFFRHMNWDDLLAWRVDPPFRPCLQSEEDVSQFDT
RFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRA
PVSPLKFSPFEGFRPSPSLPEPTELPLPPLLPPPPPSTTAPLPIRPPSGTKKSKRGRGRP
GR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50192071
n/a
NameBDBM50192071
Synonyms:(13R,15S)-13-methyl-16-oxa-8,9,12,22,24-pentaazahexacyclo[15.6.2.1^{6,9}.1^{12,15}.0^{2,7}.0^{21,25}]heptacosa-1(24),2,4,6(27),7,17(25),18,20,22-nonaene-23,27-diol | CHEMBL215803
TypeSmall organic molecule
Emp. Form.C22H21N5O3
Mol. Mass.403.4338
SMILESC[C@@H]1C[C@H]2CN1CCn1[nH]c3c(cccc3c1=O)-c1nc3c(O2)cccc3[nH]c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: