Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50145022 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_445893 (CHEMBL896183) |
---|
Ki | 1.57±n/a nM |
---|
Citation | Ferorelli, S; Abate, C; Colabufo, NA; Niso, M; Inglese, C; Berardi, F; Perrone, R Design and evaluation of naphthol- and carbazole-containing fluorescent sigma ligands as potential probes for receptor binding studies. J Med Chem50:4648-55 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
Type: | Protein |
Mol. Mass.: | 25307.17 |
Organism: | Cavia porcellus (Guinea pig) |
Description: | Q60492 |
Residue: | 223 |
Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
BDBM50145022 |
---|
n/a |
---|
Name | BDBM50145022 |
Synonyms: | 1-Cyclohexyl-4-[3-(5-methoxy-naphthalen-1-yl)-propyl]-piperazine | 1-cyclohexyl-4-(3-(5-methoxynaphthalen-1-yl)propyl)piperazine | CHEMBL535856 | CHEMBL75286 | PB-183 |
Type | Small organic molecule |
Emp. Form. | C24H34N2O |
Mol. Mass. | 366.5396 |
SMILES | COc1cccc2c(CCCN3CCN(CC3)C3CCCCC3)cccc12 |
Structure |
|