| Reaction Details |
|---|
 | Report a problem with these data |
| Target | C-X-C chemokine receptor type 2 |
|---|
| Ligand | BDBM50203017 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_454110 (CHEMBL903301) |
|---|
| IC50 | 28±n/a nM |
|---|
| Citation |  McCleland, BW; Davis, RS; Palovich, MR; Widdowson, KL; Werner, ML; Burman, M; Foley, JJ; Schmidt, DB; Sarau, HM; Rogers, M; Salyers, KL; Gorycki, PD; Roethke, TJ; Stelman, GJ; Azzarano, LM; Ward, KW; Busch-Petersen, J Comparison of N,N'-diarylsquaramides and N,N'-diarylureas as antagonists of the CXCR2 chemokine receptor. Bioorg Med Chem Lett17:1713-7 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| C-X-C chemokine receptor type 2 |
|---|
| Name: | C-X-C chemokine receptor type 2 |
|---|
| Synonyms: | C-X-C chemokine receptor type 2 (CXCR-2) | C-X-C chemokine receptor type 2 (CXCR2) | CD_antigen=CD182 | CDw128b | CXCR-2 | CXCR2 | CXCR2_HUMAN | Chemokine receptor type 2 (CXCR2) | GRO/MGSA receptor | High affinity interleukin-8 receptor B | IL-8 receptor type 2 | IL-8R B | IL8RB | Interleukin-8 receptor B |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 40767.88 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P25025 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFL
LSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCK
VVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPV
LLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFK
AHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATE
ILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL
|
|
|
|---|
| BDBM50203017 |
|---|
| n/a |
|---|
| Name | BDBM50203017 |
|---|
| Synonyms: | 3-(2-bromophenylamino)-4-(4-chloro-2-hydroxy-3-(pyrrolidine-1-carbonyl)phenylamino)cyclobut-3-ene-1,2-dione | CHEMBL399223 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H17BrClN3O4 |
|---|
| Mol. Mass. | 490.734 |
|---|
| SMILES | Oc1c(Nc2c(Nc3ccccc3Br)c(=O)c2=O)ccc(Cl)c1C(=O)N1CCCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
