Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanocortin receptor 5 (MC5R)
LigandBDBM50027084
Substrate/Competitorn/a
Meas. Tech.ChEMBL_460505
EC50 3.3±n/a nM
Citation Mayorov AVCai MPalmer ESDedek MMCain JPVan Scoy ARTan BVagner JTrivedi DHruby VJ Structure-activity relationships of cyclic lactam analogues of alpha-melanocyte-stimulating hormone (alpha-MSH) targeting the human melanocortin-3 receptor. J Med Chem 51:187-95 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melanocortin receptor 5 (MC5R)
Name:Melanocortin receptor (M4 and M5)
Synonyms:MC-2 | MC5-R | MC5R | Melanocortin MC5 | Melanocortin receptor 5
Type:Enzyme
Mol. Mass.:36612.92
Organism:Homo sapiens (Human)
Description:P33032
Residue:325
Sequence:
MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDMGIAVEVFLTLGVISLLENILVIGA
IVKNKNLHSPMYFFVCSLAVADMLVSMSSAWETITIYLLNNKHLVIADAFVRHIDNVFDS
MICISVVASMCSLLAIAVDRYVTIFYALRYHHIMTARRSGAIIAGIWAFCTGCGIVFILY
SESTYVILCLISMFFAMLFLLVSLYIHMFLLARTHVKRIAALPGASSARQRTSMQGAVTV
TMLLGVFTVCWAPFFLHLTLMLSCPQNLYCSRFMSHFNMYLILIMCNSVMDPLIYAFRSQ
EMRKTFKEIICCRGFRIACSFPRRD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50027084
n/a
NameBDBM50027084
Synonyms:MELATONAN | Melatonan
TypeSmall organic molecule
Emp. Form.C50H69N15O9
Mol. Mass.1024.178
SMILESCCCC[C@H](NC(C)=O)C(=O)N[C@H]1CC(=O)NCCCC[C@H](NC(=O)[C@H](Cc2c[nH]c3ccccc23)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](Cc2ccccc2)NC(=O)[C@H](Cc2cnc[nH]2)NC1=O)C(N)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: