| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Arachidonate 5-lipoxygenase-activating protein |
|---|
| Ligand | BDBM50235114 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_462693 (CHEMBL929667) |
|---|
| IC50 | 134±n/a nM |
|---|
| Citation |  Macdonald, D; Brideau, C; Chan, CC; Falgueyret, JP; Frenette, R; Guay, J; Hutchinson, JH; Perrier, H; Prasit, P; Riendeau, D; Tagari, P; Thérien, M; Young, RN; Girard, Y Substituted 2,2-bisaryl-bicycloheptanes as novel and potent inhibitors of 5-lipoxygenase activating protein. Bioorg Med Chem Lett18:2023-7 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Arachidonate 5-lipoxygenase-activating protein |
|---|
| Name: | Arachidonate 5-lipoxygenase-activating protein |
|---|
| Synonyms: | 5-lipoxygenase activating protein | 5-lipoxygenase-activating protein (FLAP) | 5-lipoxygenase/FLAP | AL5AP_HUMAN | ALOX5AP | FLAP | MK-886-binding protein |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18159.90 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P20292 |
|---|
| Residue: | 161 |
|---|
| Sequence: | MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNC
VDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL
FLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
|
|
|
|---|
| BDBM50235114 |
|---|
| n/a |
|---|
| Name | BDBM50235114 |
|---|
| Synonyms: | 2-((2-(2-phenylbicyclo[2.2.1]heptan-2-yl)-4-(pyridin-3-ylmethoxy)phenoxy)methyl)pyridine | CHEMBL415093 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H30N2O2 |
|---|
| Mol. Mass. | 462.5821 |
|---|
| SMILES | C(Oc1ccc(OCc2ccccn2)c(c1)C1(CC2CCC1C2)c1ccccc1)c1cccnc1 |w:18.20,21.22,16.26,THB:14:16:20.19:22,TEB:23:16:20.19:22| |
|---|
| Structure | 
|
|---|
Search and Browse
