| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 1 |
|---|
| Ligand | BDBM7720 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_468974 (CHEMBL952119) |
|---|
| IC50 | 2.8±n/a nM |
|---|
| Citation |  Kolb, P; Huang, D; Dey, F; Caflisch, A Discovery of kinase inhibitors by high-throughput docking and scoring based on a transferable linear interaction energy model. J Med Chem51:1179-88 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-dependent kinase 1 |
|---|
| Name: | Cyclin-dependent kinase 1 |
|---|
| Synonyms: | CDC2 | CDC28A | CDK1 | CDK1_HUMAN | CDKN1 | Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | P34CDC2 | p34 protein kinase |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 34101.08 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P06493 |
|---|
| Residue: | 297 |
|---|
| Sequence: | MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
|
|
|
|---|
| BDBM7720 |
|---|
| n/a |
|---|
| Name | BDBM7720 |
|---|
| Synonyms: | (3Z)-2-oxo-3-[2-(4-sulfamoylphenyl)hydrazin-1-ylidene]-2,3-dihydro-1H-indole-5-carboxamide | 3-{[4-(Aminosulfonyl)phenyl]hydrazono}-2-oxo-2,3-dihydro-1H-indole-5-carboxamide | Oxindole-Based Inhibitor 56 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H13N5O4S |
|---|
| Mol. Mass. | 359.36 |
|---|
| SMILES | NC(=O)c1ccc2NC(=O)C(=NNc3ccc(cc3)S(N)(=O)=O)c2c1 |w:11.11| |
|---|
| Structure | 
|
|---|
Search and Browse
