Reaction Details |
| Report a problem with these data |
Target | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI |
---|
Ligand | BDBM50377089 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_479301 (CHEMBL933673) |
---|
IC50 | 800±n/a nM |
---|
Citation | Tipparaju, SK; Joyasawal, S; Forrester, S; Mulhearn, DC; Pegan, S; Johnson, ME; Mesecar, AD; Kozikowski, AP Design and synthesis of 2-pyridones as novel inhibitors of the Bacillus anthracis enoyl-ACP reductase. Bioorg Med Chem Lett18:3565-9 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Enoyl-[acyl-carrier-protein] reductase [NADH] FabI |
---|
Name: | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI |
Synonyms: | CSI15 | Cold shock-induced protein 15 | ENR | Enoyl-[acyl-carrier-protein] reductase [NADH] | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI | FABI_BACSU | NADH-dependent enoyl-ACP reductase | VEG241 | Vegetative protein 241 | fabI | yjbW |
Type: | PROTEIN |
Mol. Mass.: | 27870.90 |
Organism: | Bacillus subtilis (strain 168) |
Description: | ChEMBL_479301 |
Residue: | 258 |
Sequence: | MNFSLEGRNIVVMGVANKRSIAWGIARSLHEAGARLIFTYAGERLEKSVHELAGTLDRND
SIILPCDVTNDAEIETCFASIKEQVGVIHGIAHCIAFANKEELVGEYLNTNRDGFLLAHN
ISSYSLTAVVKAARPMMTEGGSIVTLTYLGGELVMPNYNVMGVAKASLDASVKYLAADLG
KENIRVNSISAGPIRTLSAKGISDFNSILKDIEERAPLRRTTTPEEVGDTAAFLFSDMSR
GITGENLHVDSGFHITAR
|
|
|
BDBM50377089 |
---|
n/a |
---|
Name | BDBM50377089 |
Synonyms: | CHEMBL261638 |
Type | Small organic molecule |
Emp. Form. | C23H21ClN2O2 |
Mol. Mass. | 392.878 |
SMILES | Clc1ccccc1Cn1ccc(OCCCn2ccc3ccccc23)cc1=O |
Structure |
|