Reaction Details |
| Report a problem with these data |
Target | Probable flavin-dependent thymidylate synthase |
---|
Ligand | BDBM50377327 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_479520 (CHEMBL924875) |
---|
Ki | 2000±n/a nM |
---|
Citation | Esra Onen, F; Boum, Y; Jacquement, C; Spanedda, MV; Jaber, N; Scherman, D; Myllykallio, H; Herscovici, J Design, synthesis and evaluation of potent thymidylate synthase X inhibitors. Bioorg Med Chem Lett18:3628-31 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Probable flavin-dependent thymidylate synthase |
---|
Name: | Probable flavin-dependent thymidylate synthase |
Synonyms: | Probable thymidylate synthase | THYX_PBCV1 | TS | TSase |
Type: | PROTEIN |
Mol. Mass.: | 24907.10 |
Organism: | Paramecium bursaria Chlorella virus 1 |
Description: | ChEMBL_479520 |
Residue: | 216 |
Sequence: | MSAKLISVTKPVVEGVNTAEELIAYAARVSNPENQINNKTASGLLKYCIRHKHWSIFETA
FMTLELKTSRGIAAQVLRHRSFHFQEFSQRYASVMETPPPHQARFQDHKNRQNSLDTVPE
DDQTWWATEQEKLYAQSMELYNKALEKGIAKECARFILPLSTPTTIYMSGTIRDWIHYIE
LRTSNGTQREHIDLANACKEIFIKEFPSIAKALDWV
|
|
|
BDBM50377327 |
---|
n/a |
---|
Name | BDBM50377327 |
Synonyms: | CHEMBL402148 |
Type | Small organic molecule |
Emp. Form. | C23H23FN4O3S |
Mol. Mass. | 454.517 |
SMILES | CCOC(=O)[C@@H]1CSC(N1C(=O)c1cn(CCc2ccc(F)cc2)nn1)c1ccccc1 |w:8.28| |
Structure |
|