| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mitogen-activated protein kinase 14 |
|---|
| Ligand | BDBM50251919 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_488009 (CHEMBL1013888) |
|---|
| IC50 | 34±n/a nM |
|---|
| Citation |  Laufer, SA; Hauser, DR; Domeyer, DM; Kinkel, K; Liedtke, AJ Design, synthesis, and biological evaluation of novel Tri- and tetrasubstituted imidazoles as highly potent and specific ATP-mimetic inhibitors of p38 MAP kinase: focus on optimized interactions with the enzyme's surface-exposed front region. J Med Chem51:4122-49 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mitogen-activated protein kinase 14 |
|---|
| Name: | Mitogen-activated protein kinase 14 |
|---|
| Synonyms: | CSAID-binding protein | CSBP | CSBP1 | CSBP2 | CSPB1 | Cytokine suppressive anti-inflammatory drug-binding protein | MAP kinase 14 | MAP kinase MXI2 | MAP kinase p38 alpha | MAPK 14 | MAPK14 | MAX-interacting protein 2 | MK14_HUMAN | MXI2 | Mitogen-activated protein kinase p38 alpha | SAPK2A | Stress-activated protein kinase 2a | p38 MAP kinase alpha/beta |
|---|
| Type: | Serine/threonine-protein kinase |
|---|
| Mol. Mass.: | 41286.76 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q16539 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
|
|
|
|---|
| BDBM50251919 |
|---|
| n/a |
|---|
| Name | BDBM50251919 |
|---|
| Synonyms: | (1,2-Dimethyl-propyl)-{4-[2-methylsulfanyl-4-(3-trifluoromethyl-phenyl)-1H-imidazol-5-yl]-pyridin-2-yl}-amine | CHEMBL482111 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H23F3N4S |
|---|
| Mol. Mass. | 420.494 |
|---|
| SMILES | CSc1nc(c([nH]1)-c1cccc(c1)C(F)(F)F)-c1ccnc(NC(C)C(C)C)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
