| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 1A |
|---|
| Ligand | BDBM21393 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_536734 (CHEMBL984528) |
|---|
| EC50 | 26±n/a nM |
|---|
| Citation |  Hatzenbuhler, NT; Baudy, R; Evrard, DA; Failli, A; Harrison, BL; Lenicek, S; Mewshaw, RE; Saab, A; Shah, U; Sze, J; Zhang, M; Zhou, D; Chlenov, M; Kagan, M; Golembieski, J; Hornby, G; Lai, M; Smith, DL; Sullivan, KM; Schechter, LE; Andree, TH Advances toward new antidepressants with dual serotonin transporter and 5-HT1A receptor affinity within a class of 3-aminochroman derivatives. Part 2. J Med Chem51:6980-7004 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 5-hydroxytryptamine receptor 1A |
|---|
| Name: | 5-hydroxytryptamine receptor 1A |
|---|
| Synonyms: | 5-HT-1A | 5-HT1A | 5-hydroxytryptamine receptor 1A (5-HT-1A) | 5HT1A_HUMAN | ADRB2RL1 | ADRBRL1 | Dopamine D2 receptor and serotonin 1a receptor | G-21 | HTR1A | Serotonin receptor 1A |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 46122.49 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 422 |
|---|
| Sequence: | MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADT
RHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGN
SKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RQ
|
|
|
|---|
| BDBM21393 |
|---|
| n/a |
|---|
| Name | BDBM21393 |
|---|
| Synonyms: | 7-(dipropylamino)-5,6,7,8-tetrahydronaphthalen-1-ol | 8-Hydroxy-2-(di-n-propylamino)tetralin | 8-OH-DPAT | 8-OH-DPAT,(+) | 8-OH-DPAT,(-) | 8-hydroxy-N,N-dipropylaminotetralin | CHEMBL1788118 | CHEMBL505765 | CHEMBL56 | DPAT | US10562853, Compound 8-OH-DPAT | [3H]-8-OH-DPAT | cid_1220 |
|---|
| Type | radiolabeled ligand |
|---|
| Emp. Form. | C16H25NO |
|---|
| Mol. Mass. | 247.3758 |
|---|
| SMILES | CCCN(CCC)C1CCc2cccc(O)c2C1 |
|---|
| Structure | 
|
|---|
Search and Browse
