| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carbonic anhydrase 5A, mitochondrial |
|---|
| Ligand | BDBM10887 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_519586 (CHEMBL943661) |
|---|
| Ki | 63000±n/a nM |
|---|
| Citation |  Smaine, FZ; Pacchiano, F; Rami, M; Barragan-Montero, V; Vullo, D; Scozzafava, A; Winum, JY; Supuran, CT Carbonic anhydrase inhibitors: 2-substituted-1,3,4-thiadiazole-5-sulfamides act as powerful and selective inhibitors of the mitochondrial isozymes VA and VB over the cytosolic and membrane-associated carbonic anhydrases I, II and IV. Bioorg Med Chem Lett18:6332-5 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Carbonic anhydrase 5A, mitochondrial |
|---|
| Name: | Carbonic anhydrase 5A, mitochondrial |
|---|
| Synonyms: | CA-VA | CA5 | CA5A | CAH5A_HUMAN | Carbonate dehydratase VA | Carbonic Anhydrase VA | Carbonic anhydrase 5A (CA VA) | Carbonic anhydrase 5A, mitochondrial | Carbonic anhydrase 5A, mitochondrial precursor | Carbonic anhydrase V | Carbonic anhydrase VA (CA VA) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 34755.54 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Human (cloned) isozyme |
|---|
| Residue: | 305 |
|---|
| Sequence: | MLGRNTWKTSAFSFLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPG
GTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPL
ENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVI
GVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLT
ESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATN
EGTRS
|
|
|
|---|
| BDBM10887 |
|---|
| n/a |
|---|
| Name | BDBM10887 |
|---|
| Synonyms: | Sulfamate 7 | Topiramate (TPM) | US11535599, Example topiramate | [(1R,2S,6S,9R)-4,4,11,11-tetramethyl-3,5,7,10,12-pentaoxatricyclo[7.3.0.0^{2,6}]dodecan-6-yl]methyl sulfamate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H21NO8S |
|---|
| Mol. Mass. | 339.362 |
|---|
| SMILES | CC1(C)O[C@@H]2CO[C@@]3(COS(N)(=O)=O)OC(C)(C)O[C@H]3[C@@H]2O1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
