Reaction Details |
| Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50241341 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_564843 (CHEMBL955070) |
---|
Ki | 38±n/a nM |
---|
Citation | Wentland, MP; Lou, R; Lu, Q; Bu, Y; Denhardt, C; Jin, J; Ganorkar, R; VanAlstine, MA; Guo, C; Cohen, DJ; Bidlack, JM Syntheses of novel high affinity ligands for opioid receptors. Bioorg Med Chem Lett19:2289-94 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40382.98 |
Organism: | Homo sapiens (Human) |
Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
Residue: | 372 |
Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50241341 |
---|
n/a |
---|
Name | BDBM50241341 |
Synonyms: | (-)-(5R)-4,5-Epoxy-3-hydroxy-9alpha-methylmorphinan-6-one | 3-hydroxy-17-methyl-4,5alpha-epoxymorphinan-6-one | 4,5-Epoxy-3-hydroxy-17-methylmorphinan-6-one | 4,5alpha-Epoxy-3-hydroxy-17-methyl-6-morphinanone | 6-Deoxy-7,8-dihydro-6-oxomorphine | 7,8-Dihydromorphinone | CHEMBL398707 | Dihydromorfinon | Dihydromorphinone | Dimorphone | HYDROMORPHONE | Hydromorfona | Hydromorphone Hydrochloride | Idromorfone |
Type | Small organic molecule |
Emp. Form. | C17H19NO3 |
Mol. Mass. | 285.3377 |
SMILES | CN1CC[C@@]23[C@H]4Oc5c2c(C[C@@H]1[C@@H]3CCC4=O)ccc5O |r| |
Structure |
|