Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50295427 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_578681 (CHEMBL1063062) |
---|
Ki | 3233±n/a nM |
---|
Citation | Zampieri, D; Mamolo, MG; Laurini, E; Florio, C; Zanette, C; Fermeglia, M; Posocco, P; Paneni, MS; Pricl, S; Vio, L Synthesis, biological evaluation, and three-dimensional in silico pharmacophore model for sigma(1) receptor ligands based on a series of substituted benzo[d]oxazol-2(3H)-one derivatives. J Med Chem52:5380-93 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25266.54 |
Organism: | RAT |
Description: | Q9R0C9 |
Residue: | 223 |
Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
BDBM50295427 |
---|
n/a |
---|
Name | BDBM50295427 |
Synonyms: | 3-[3-[N-(3-Chlorobenzyl)-N-methylamino]propyl]benzo[d]oxazol-2(3H)-one | CHEMBL557708 |
Type | Small organic molecule |
Emp. Form. | C18H19ClN2O2 |
Mol. Mass. | 330.809 |
SMILES | CN(CCCn1c2ccccc2oc1=O)Cc1cccc(Cl)c1 |
Structure |
|