| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50295427 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_578681 (CHEMBL1063062) |
|---|
| Ki | 3233±n/a nM |
|---|
| Citation |  Zampieri, D; Mamolo, MG; Laurini, E; Florio, C; Zanette, C; Fermeglia, M; Posocco, P; Paneni, MS; Pricl, S; Vio, L Synthesis, biological evaluation, and three-dimensional in silico pharmacophore model for sigma(1) receptor ligands based on a series of substituted benzo[d]oxazol-2(3H)-one derivatives. J Med Chem52:5380-93 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25266.54 |
|---|
| Organism: | RAT |
|---|
| Description: | Q9R0C9 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50295427 |
|---|
| n/a |
|---|
| Name | BDBM50295427 |
|---|
| Synonyms: | 3-[3-[N-(3-Chlorobenzyl)-N-methylamino]propyl]benzo[d]oxazol-2(3H)-one | CHEMBL557708 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H19ClN2O2 |
|---|
| Mol. Mass. | 330.809 |
|---|
| SMILES | CN(CCCn1c2ccccc2oc1=O)Cc1cccc(Cl)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
