Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstanoid DP receptor
LigandBDBM50302830
Substrate/Competitorn/a
Meas. Tech.ChEMBL_595294
IC50 36±n/a nM
Citation Liu JFu ZWang YSchmitt MHuang AMarshall DTonn GSeitz LSullivan TLucy Tang HCollins TMedina J Discovery and optimization of CRTH2 and DP dual antagonists. Bioorg Med Chem Lett 19:6419-23 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostanoid DP receptor
Name:Prostanoid DP receptor
Synonyms:Prostaglandin D2 | Prostaglandin D2 receptor
Type:Enzyme
Mol. Mass.:40288.87
Organism:Homo sapiens (Human)
Description:Q13258
Residue:359
Sequence:
MKSPFYRCQNTTSVEKGNSAVMGGVLFSTGLLGNLLALGLLARSGLGWCSRRPLRPLPSV
FYMLVCGLTVTDLLGKCLLSPVVLAAYAQNRSLRVLAPALDNSLCQAFAFFMSFFGLSST
LQLLAMALECWLSLGHPFFYRRHITLRLGALVAPVVSAFSLAFCALPFMGFGKFVQYCPG
TWCFIQMVHEEGSLSVLGYSVLYSSLMALLVLATVLCNLGAMRNLYAMHRRLQRHPRSCT
RDCAEPRADGREASPQPLEELDHLLLLALMTVLFTMCSLPVIYRAYYGAFKDVKEKNRTS
EEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIFIRPLRYRSRCSNSTNMESSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50302830
n/a
NameBDBM50302830
Synonyms:2-(4-(2-(2,4-dichlorophenylsulfonamido)-4-(isopropylcarbamoyl)phenoxy)-3-methoxyphenyl)acetic acid | CHEMBL569772
TypeSmall organic molecule
Emp. Form.C25H24Cl2N2O7S
Mol. Mass.567.438
SMILESCOc1cc(CC(O)=O)ccc1Oc1ccc(cc1NS(=O)(=O)c1ccc(Cl)cc1Cl)C(=O)NC(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: