Reaction Details |
| Report a problem with these data |
Target | Orexin/Hypocretin receptor type 1 |
---|
Ligand | BDBM50318697 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_633511 (CHEMBL1119825) |
---|
IC50 | 27±n/a nM |
---|
Citation | Cox, CD; Breslin, MJ; Whitman, DB; Schreier, JD; McGaughey, GB; Bogusky, MJ; Roecker, AJ; Mercer, SP; Bednar, RA; Lemaire, W; Bruno, JG; Reiss, DR; Harrell, CM; Murphy, KL; Garson, SL; Doran, SM; Prueksaritanont, T; Anderson, WB; Tang, C; Roller, S; Cabalu, TD; Cui, D; Hartman, GD; Young, SD; Koblan, KS; Winrow, CJ; Renger, JJ; Coleman, PJ Discovery of the dual orexin receptor antagonist [(7R)-4-(5-chloro-1,3-benzoxazol-2-yl)-7-methyl-1,4-diazepan-1-yl][5-methyl-2-(2H-1,2,3-triazol-2-yl)phenyl]methanone (MK-4305) for the treatment of insomnia. J Med Chem53:5320-32 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Orexin/Hypocretin receptor type 1 |
---|
Name: | Orexin/Hypocretin receptor type 1 |
Synonyms: | HCRTR1 | Hypocretin receptor type 1 | OX1R_HUMAN | Orexin receptor type 1 | Orexin receptor type 1 (OR 1) | Orexin receptor type 1 (OR-1) | Orexin receptor type 1 (OX1) | Orexin receptor type 1 (OX1R) | Orexin receptor type 1 (OxR1) | Ox1r |
Type: | Protein |
Mol. Mass.: | 47554.50 |
Organism: | Homo sapiens (Human) |
Description: | O43613 |
Residue: | 425 |
Sequence: | MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVA
LVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCK
VIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQA
AVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFR
KLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKML
MVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNF
LSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSV
TTVLP
|
|
|
BDBM50318697 |
---|
n/a |
---|
Name | BDBM50318697 |
Synonyms: | 6-Fluoro-2-{(5R)-5-Methyl-4-[5-methyl-2-(2H-1,2,3-triazol-2-yl)benzoyl]-1,4-diazepan-1-yl}quinazoline | CHEMBL1083358 |
Type | Small organic molecule |
Emp. Form. | C23H22FN7O |
Mol. Mass. | 431.4655 |
SMILES | C[C@@H]1CCN(CCN1C(=O)c1ccccc1-n1nccn1)c1ncc2cc(F)ccc2n1 |r| |
Structure |
|