Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDNA topoisomerase I (Topo I)
LigandBDBM50326182
Substrate/Competitorn/a
Meas. Tech.ChEMBL_659083
IC50>100000±n/a nM
Citation Tseng CHTzeng CCYang CLLu PJChen HLLi HYChuang YCYang CNChen YL Synthesis and antiproliferative evaluation of certain indeno[1,2-c]quinoline derivatives. Part 2. J Med Chem 53:6164-79 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
DNA topoisomerase I (Topo I)
Name:DNA topoisomerase I
Synonyms:DNA topoisomerase I
Type:Enzyme
Mol. Mass.:90771.02
Organism:Homo sapiens (Human)
Description:P11387
Residue:765
Sequence:
MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKK
HKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKVRASGDAKIKKEKENGFSSPPQIKDEP
EDDGYFVPPKEDIKPLKRPRDEDDADYKPKKIKTEDTKKEKKRKLEEEEDGKLKKPKNKD
KDKKVPEPDNKKKKPKKEEEQKWKWWEEERYPEGIKWKFLEHKGPVFAPPYEPLPENVKF
YYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMTNEEKNIITNLSKC
DFTQMSQYFKAQTEARKQMSKEEKLKIKEENEKLLKEYGFCIMDNHKERIANFKIEPPGL
FRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLVSWTENI
QGSIKYIMLNPSSRIKGEKDWQKYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALY
FIDKLALRAGNEKEEGETADTVGCCSLRVEHINLHPELDGQEYVVEFDFLGKDSIRYYNK
VPVEKRVFKNLQLFMENKQPEDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYNASITLQQ
QLKELTAPDENIPAKILSYNRANRAVAILCNHQRAPPKTFEKSMMNLQTKIDAKKEQLAD
ARRDLKSAKADAKVMKDAKTKKVVESKKKAVQRLEEQLMKLEVQATDREENKQIALGTSK
LNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50326182
n/a
NameBDBM50326182
Synonyms:(E)-6-Hydroxy-9-methoxy-11H-indeno[1,2-c]quinolin-11-one O-3-(Dimethylamino)propyl Oxime | CHEMBL1243199
TypeSmall organic molecule
Emp. Form.C22H23N3O3
Mol. Mass.377.4363
SMILESCOc1ccc-2c(c1)\C(=N/OCCCN(C)C)c1c-2c(=O)[nH]c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: