| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tyrosine-protein phosphatase non-receptor type 7 |
|---|
| Ligand | BDBM50336849 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_718181 (CHEMBL1679227) |
|---|
| IC50 | >50000±n/a nM |
|---|
| Citation |  Bobkova, EV; Liu, WH; Colayco, S; Rascon, J; Vasile, S; Gasior, C; Critton, DA; Chan, X; Dahl, R; Su, Y; Sergienko, E; Chung, TD; Mustelin, T; Page, R; Tautz, L Inhibition of the Hematopoietic Protein Tyrosine Phosphatase by Phenoxyacetic Acids. ACS Med Chem Lett2:113-118 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Tyrosine-protein phosphatase non-receptor type 7 |
|---|
| Name: | Tyrosine-protein phosphatase non-receptor type 7 |
|---|
| Synonyms: | He-PTP | Hematopoietic protein-tyrosine phosphatase | Hematopoietic protein-tyrosine phosphatase (HEPTP) | PTN7_HUMAN | PTPN7 | Protein-tyrosine phosphatase LC-PTP | Tyrosine-protein phosphatase non-receptor type 7 | Tyrosine-protein phosphatase non-receptor type 7 (HEPTP) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 40530.79 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P35236 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MVQAHGGRSRAQPLTLSLGAAMTQPPPEKTPAKKHVRLQERRGSNVALMLDVRSLGAVEP
ICSVNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHA
SKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFW
EMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQDMKECPEYTVRQLTIQY
QEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGC
FIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
|
|
|
|---|
| BDBM50336849 |
|---|
| n/a |
|---|
| Name | BDBM50336849 |
|---|
| Synonyms: | CHEMBL1672296 | ethyl 7-methyl-3-oxo-5-(thiophen-2-yl)-2-(3,4,5-trimethoxybenzylidene)-3,5-dihydro-2H-thiazolo[3,2-a]pyrimidine-6-carboxylate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H24N2O6S2 |
|---|
| Mol. Mass. | 500.587 |
|---|
| SMILES | CCOC(=O)C1=C(C)N=c2s\c(=C/c3cc(OC)c(OC)c(OC)c3)c(=O)n2C1c1cccs1 |c:5,t:8| |
|---|
| Structure | 
|
|---|
Search and Browse
