| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50350912 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_763591 (CHEMBL1820032) |
|---|
| Ki | 0.44±n/a nM |
|---|
| Citation |  Damont, A; Boisgard, R; Kuhnast, B; Lemée, F; Raggiri, G; Scarf, AM; Da Pozzo, E; Selleri, S; Martini, C; Tavitian, B; Kassiou, M; Dollé, F Synthesis of 6-[¹8F]fluoro-PBR28, a novel radiotracer for imaging the TSPO 18 kDa with PET. Bioorg Med Chem Lett21:4819-22 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
|---|
| Type: | Mitochondrion membrane protein |
|---|
| Mol. Mass.: | 18945.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
|---|
| Residue: | 169 |
|---|
| Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
|---|
| BDBM50350912 |
|---|
| n/a |
|---|
| Name | BDBM50350912 |
|---|
| Synonyms: | CHEMBL1817978 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H19FN2O3 |
|---|
| Mol. Mass. | 366.3856 |
|---|
| SMILES | COc1ccccc1CN(C(C)=O)c1cnc(F)cc1Oc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
