Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual-specificity tyrosine-phosphorylation regulated kinase 2
LigandBDBM50379526
Substrate/Competitorn/a
Meas. Tech.ChEMBL_812378
IC50>10000±n/a nM
Citation Cuny GDUlyanova NPPatnaik DLiu JFLin XAuerbach KRay SSXian JGlicksman MAStein RLHiggins JM Structure-activity relationship study of beta-carboline derivatives as haspin kinase inhibitors. Bioorg Med Chem Lett 22:2015-9 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dual-specificity tyrosine-phosphorylation regulated kinase 2
Name:Dual-specificity tyrosine-phosphorylation regulated kinase 2
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:66690.69
Organism:Homo sapiens (Human)
Description:ChEMBL_1508025
Residue:601
Sequence:
MLTRKPSAAAPAAYPTGRGGDSAVRQLQASPGLGAGATRSGVGTGPPSPIALPPLRASNA
AAAAHTIGGSKHTMNDHLHVGSHAHGQIQVQQLFEDNSNKRTVLTTQPNGLTTVGKTGLP
VVPERQLDSIHRRQGSSTSLKSMEGMGKVKATPMTPEQAMKQYMQKLTAFEHHEIFSYPE
IYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAY
DHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMT
FELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQG
RSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYP
LLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSDGSVVLNGG
RSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLP
KPPTGEKTSVKRITESTGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLPKLV
S
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50379526
n/a
NameBDBM50379526
Synonyms:CHEMBL2012563
TypeSmall organic molecule
Emp. Form.C16H19N3O
Mol. Mass.269.3416
SMILESCc1nccc2c3ccc(O)cc3n(CCCCN)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: