Reaction Details |
| Report a problem with these data |
Target | Cannabinoid receptor 2 |
---|
Ligand | BDBM50379694 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_812058 (CHEMBL2013484) |
---|
IC50 | 9.55±n/a nM |
---|
Citation | Nelson, DW; Frost, JM; Tietje, KR; Florjancic, AS; Ryther, K; Carroll, WA; Dart, MJ; Daza, AV; Hooker, BA; Grayson, GK; Fan, Y; Garrison, TR; El-Kouhen, OF; Yao, B; Pai, M; Chandran, P; Zhu, C; Hsieh, GC; Meyer, MD Synthesis and evaluation of 2-amido-3-carboxamide thiophene CB2 receptor agonists for pain management. Bioorg Med Chem Lett22:2604-8 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cannabinoid receptor 2 |
---|
Name: | Cannabinoid receptor 2 |
Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CNR2_RAT | Cannabinoid CB2 receptor | Cannabinoid receptor | Cnr2 | rCB2 |
Type: | Enzyme |
Mol. Mass.: | 39366.68 |
Organism: | Rattus norvegicus (Rat) |
Description: | Q9QZN9 |
Residue: | 360 |
Sequence: | MAGCRELELTNGSNGGLEFNPMKEYMILSDAQQIAVAVLCTLMGLLSALENVAVLYLILS
SQRLRRKPSYLFIGSLAGADFLASVIFACNFVIFHVFHGVDSRNIFLLKIGSVTMTFTAS
VGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALGVMWVLSALISYLPLMGWTCCPSPCS
ELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHQHVASLAEHQDRQVPGIARMRLD
VRLAKTLGLVMAVLLICWFPALALMGHSLVTTLSDKVKEAFAFCSMLCLVNSMINPIIYA
LRSGEIRSAAQHCLTGWKKYLQGLGSEGKEEAPKSSVTETEAEVKTTTGPGSRTPGCSNC
|
|
|
BDBM50379694 |
---|
n/a |
---|
Name | BDBM50379694 |
Synonyms: | CHEMBL2010900 |
Type | Small organic molecule |
Emp. Form. | C21H24F2N2O3S |
Mol. Mass. | 422.489 |
SMILES | FC1(F)CN(C1)C(=O)c1c(NC(=O)C23CC4CC2CC(C3)C4)sc2COCCc12 |TLB:14:13:21.15.16:18,THB:11:13:21.15.16:18,14:15:18:20.13| |
Structure |
|