| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sphingosine 1-phosphate receptor 1 |
|---|
| Ligand | BDBM50380341 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_813865 (CHEMBL2020234) |
|---|
| EC50 | 230±n/a nM |
|---|
| Citation |  Pennington, LD; Sham, KK; Pickrell, AJ; Harrington, PE; Frohn, MJ; Lanman, BA; Reed, AB; Croghan, MD; Lee, MR; Xu, H; McElvain, M; Xu, Y; Zhang, X; Fiorino, M; Horner, M; Morrison, HG; Arnett, HA; Fotsch, C; Wong, M; Cee, VJ 4-Methoxy-N-[2-(trifluoromethyl)biphenyl-4-ylcarbamoyl]nicotinamide: A Potent and Selective Agonist of S1P1. ACS Med Chem Lett2:752-757 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sphingosine 1-phosphate receptor 1 |
|---|
| Name: | Sphingosine 1-phosphate receptor 1 |
|---|
| Synonyms: | CHEDG1 | EDG1 | Endothelial differentiation G-protein coupled receptor 1 | S1P receptor | S1P1 | S1PR1 | S1PR1_HUMAN | Sphingosine 1-phosphate receptor 1 (S1PR1) | Sphingosine 1-phosphate receptor Edg-1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 42836.02 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P21453 |
|---|
| Residue: | 382 |
|---|
| Sequence: | MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFII
LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR
EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIM
GWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN
ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA
VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSH
PQKDEGDNPETIMSSGNVNSSS
|
|
|
|---|
| BDBM50380341 |
|---|
| n/a |
|---|
| Name | BDBM50380341 |
|---|
| Synonyms: | CHEMBL2017804 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H22ClN3O3 |
|---|
| Mol. Mass. | 387.86 |
|---|
| SMILES | COc1ccccc1C(=O)NC(=O)Nc1ccc(N2CCCCC2)c(Cl)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
