Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVasopressin V1a receptor
LigandBDBM50380758
Substrate/Competitorn/a
Meas. Tech.ChEMBL_813471
Ki 790±n/a nM
Citation Smith ALFreeman SMStehouwer JSInoue KVoll RJYoung LJGoodman MM Synthesis and evaluation of C-11, F-18 and I-125 small molecule radioligands for detecting oxytocin receptors. Bioorg Med Chem 20:2721-38 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Vasopressin V1a receptor
Name:Vasopressin V1a receptor
Synonyms:AVPR V1a | AVPR1 | AVPR1A | Antidiuretic hormone receptor 1a | V1aR | VASOPRESSIN V1A | Vascular/hepatic-type arginine vasopressin receptor | Vasopressin V1 receptor
Type:Receptor
Mol. Mass.:46820.18
Organism:Homo sapiens (Human)
Description:P37288
Residue:418
Sequence:
MRLSAGPDAGPSGNSSPWWPLATGAGNTSREAEALGEGNGPPRDVRNEELAKLEIAVLAV
TFAVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQMCWDITYRFRGP
DWLCRVVKHLQVFGMFASAYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIAAAWVLSFV
LSTPQYFVFSMIEVNNVTKARDCWATFIQPWGSRAYVTWMTGGIFVAPVVILGTCYGFIC
YNIWCNVRGKTASRQSKGAEQAGVAFQKGFLLAPCVSSVKSISRAKIRTVKMTFVIVTAY
IVCWAPFFIIQMWSVWDPMSVWTESENPTITITALLGSLNSCCNPWIYMFFSGHLLQDCV
QSFPCCQNMKEKFNKEDTDSMSRRQTFYSNNRSPTNSTGMWKDSPKSSKSIKFIPVST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50380758
n/a
NameBDBM50380758
Synonyms:CHEMBL2017867
TypeSmall organic molecule
Emp. Form.C31H38IN3O6S
Mol. Mass.707.619
SMILESCS(=O)(=O)N1CCC(CC1)Oc1ccc(CC(=O)N2CCC(CC2)N2C(=O)CCc3ccccc23)c(OC\C=C\I)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: