Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPancreatic lipase
LigandBDBM50381861
Substrate/Competitorn/a
Meas. Tech.ChEMBL_817315
Ki 39000±n/a nM
Citation Park SYu J An approach for differentiating isozymes. Construction of libraries containing short aromatic peptides as part of a method to design selective inhibitors against lipases. Bioorg Med Chem Lett 22:3147-51 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Pancreatic lipase
Name:Pancreatic triacylglycerol lipase
Synonyms:PL | PTL | Pancreatic triacylglycerol lipase
Type:Enzyme
Mol. Mass.:50080.69
Organism:Sus scrofa (Pig)
Description:P00591
Residue:450
Sequence:
SEVCFPRLGCFSDDAPWAGIVQRPLKILPWSPKDVDTRFLLYTNQNQNNYQELVADPSTI
TNSNFRMDRKTRFIIHGFIDKGEEDWLSNICKNLFKVESVNCICVDWKGGSRTGYTQASQ
NIRIVGAEVAYFVEVLKSSLGYSPSNVHVIGHSLGSHAAGEAGRRTNGTIERITGLDPAE
PCFQGTPELVRLDPSDAKFVDVIHTDAAPIIPNLGFGMSQTVGHLDFFPNGGKQMPGCQK
NILSQIVDIDGIWEGTRDFVACNHLRSYKYYADSILNPDGFAGFPCDSYNVFTANKCFPC
PSEGCPQMGHYADRFPGKTNGVSQVFYLNTGDASNFARWRYKVSVTLSGKKVTGHILVSL
FGNEGNSRQYEIYKGTLQPDNTHSDEFDSDVEVGDLQKVKFIWYNNNVINPTLPRVGASK
ITVERNDGKVYDFCSQETVREEVLLTLNPC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50381861
n/a
NameBDBM50381861
Synonyms:CHEMBL2022676
TypeSmall organic molecule
Emp. Form.C35H44N4O5
Mol. Mass.600.7477
SMILESCCCCCCCOc1ccc(NC(=O)CCC(=O)N[C@@H](Cc2ccccc2)C(=O)N[C@@H](Cc2ccccc2)C(N)=O)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: