Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPancreatic lipase
LigandBDBM50381860
Substrate/Competitorn/a
Meas. Tech.ChEMBL_817316
Ki 170000±n/a nM
Citation Park SYu J An approach for differentiating isozymes. Construction of libraries containing short aromatic peptides as part of a method to design selective inhibitors against lipases. Bioorg Med Chem Lett 22:3147-51 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Pancreatic lipase
Name:Pancreatic lipase
Synonyms:PL
Type:PROTEIN
Mol. Mass.:51157.75
Organism:Homo sapiens (Human)
Description:ChEMBL_527250
Residue:465
Sequence:
MLPLWTLSLLLGAVAGKEVCYERLGCFSDDSPWSGITERPLHILPWSPKDVNTRFLLYTN
ENPNNFQEVAADSSSISGSNFKTNRKTRFIIHGFIDKGEENWLANVCKNLFKVESVNCIC
VDWKGGSRTGYTQASQNIRIVGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAGEAGR
RTNGTIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMSQVVGH
LDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGF
PCASYNVFTANKCFPCPSGGCPQMGHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVS
VTLSGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQMVKFIWY
NNVINPTLPRVGASKIIVETNVGKQFNFCSPETVREEVLLTLTPC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50381860
n/a
NameBDBM50381860
Synonyms:CHEMBL2022680
TypeSmall organic molecule
Emp. Form.C32H38N4O6
Mol. Mass.574.6673
SMILESCCCCOc1ccc(NC(=O)CCC(=O)N[C@@H](Cc2ccc(O)cc2)C(=O)N[C@@H](Cc2ccccc2)C(N)=O)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: