Reaction Details |
| Report a problem with these data |
Target | Aldo-keto reductase family 1 member C2 |
---|
Ligand | BDBM50337278 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_823518 (CHEMBL2046256) |
---|
IC50 | 440±n/a nM |
---|
Citation | Adeniji, AO; Twenter, BM; Byrns, MC; Jin, Y; Chen, M; Winkler, JD; Penning, TM Development of potent and selective inhibitors of aldo-keto reductase 1C3 (type 5 17ß-hydroxysteroid dehydrogenase) based on N-phenyl-aminobenzoates and their structure-activity relationships. J Med Chem55:2311-23 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Aldo-keto reductase family 1 member C2 |
---|
Name: | Aldo-keto reductase family 1 member C2 |
Synonyms: | 3-alpha-HSD3 | 3-alpha-Hydroxysteroid Dehydrogenase Type 3 (AKR1C2) | AK1C2_HUMAN | AKR1C2 | Aldo-keto reductase family 1 member C2 (AK1C2) | Aldo-keto reductase family 1 member C2 (AK1C2a) | Aldo-keto reductase family 1 member C2 (AKR1C2) | Chlordecone reductase homolog HAKRD | DD-2 | DD/BABP | DDH2 | Dihydrodiol dehydrogenase 2 | Dihydrodiol dehydrogenase/bile acid-binding protein | Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase | Type III 3-alpha-hydroxysteroid dehydrogenase |
Type: | Enzyme |
Mol. Mass.: | 36739.89 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 323 |
Sequence: | MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPV
SVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKP
GLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPV
LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN
RNVRYLTLDIFAGPPNYPFSDEY
|
|
|
BDBM50337278 |
---|
n/a |
---|
Name | BDBM50337278 |
Synonyms: | 2-(phenylamino)benzoic acid | 2-Phenylamino-benzoic acid | CHEMBL23832 | N-phenylanthranilic acid | US9271961, 2 | phenylanthranilic acid |
Type | Small organic molecule |
Emp. Form. | C13H11NO2 |
Mol. Mass. | 213.2319 |
SMILES | OC(=O)c1ccccc1Nc1ccccc1 |
Structure |
|