Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone deacetylase 1
LigandBDBM50386662
Substrate/Competitorn/a
Meas. Tech.ChEMBL_826884
IC50 71.2±n/a nM
Citation Lai MJHuang HLPan SLLiu YMPeng CYLee HYYeh TKHuang PHTeng CMChen CSChuang HYLiou JP Synthesis and biological evaluation of 1-arylsulfonyl-5-(N-hydroxyacrylamide)indoles as potent histone deacetylase inhibitors with antitumor activity in vivo. J Med Chem 55:3777-91 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone deacetylase 1
Name:Histone deacetylase 1
Synonyms:HD1 | Histone deacetylase 1 (HDAC1) | Human HDAC1 | RPD3L1
Type:Enzyme
Mol. Mass.:55090.27
Organism:Homo sapiens (Human)
Description:Q13547
Residue:482
Sequence:
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEF
SDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK
LA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50386662
n/a
NameBDBM50386662
Synonyms:CHEMBL2048755
TypeSmall organic molecule
Emp. Form.C18H16N2O2
Mol. Mass.292.3318
SMILESONC(=O)\C=C\c1ccc2n(Cc3ccccc3)ccc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: