Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlucose Transporter 1 (hGLUT1)
LigandBDBM50388391
Substrate/Competitorn/a
Meas. Tech.ChEMBL_829819
IC50 5000±n/a nM
Citation Wang DChu PCYang CNYan RChuang YCKulp SKChen CS Development of a novel class of glucose transporter inhibitors. J Med Chem 55:3827-36 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glucose Transporter 1 (hGLUT1)
Name:Glucose transporter
Synonyms:GLUT-1 | Glucose transporter | Glucose transporter type 1, erythrocyte/brain | HepG2 glucose transporter | SLC2A1
Type:Protein
Mol. Mass.:54091.71
Organism:Homo sapiens (Human)
Description:n/a
Residue:492
Sequence:
MEPSSKKLTGRLMLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYNQTWVHRYGESILPTT
LTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFE
MLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIM
GNKDLWPLLLSIIFIPALLQCIVLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTHD
LQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEK
AGVQQPVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAILMTIALALLEQ
LPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGM
CFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPE
ELFHPLGADSQV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50388391
n/a
NameBDBM50388391
Synonyms:CHEMBL2057965
TypeSmall organic molecule
Emp. Form.C17H18F3NO3S
Mol. Mass.373.39
SMILESCCC(CC)CN1C(=O)S\C(=C/c2ccc(O)c(c2)C(F)(F)F)C1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: